DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and DBX2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001004329.2 Gene:DBX2 / 440097 HGNCID:33186 Length:339 Species:Homo sapiens


Alignment Length:245 Identity:74/245 - (30%)
Similarity:97/245 - (39%) Gaps:87/245 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PPPHNS----TTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIA-PTSPAAAAAAT------ 268
            |.||:.    .||.|.|.||.:              ...|.:|...| ..|||.|...|      
Human    57 PAPHDPATALATAGAQLRPLPA--------------SPVPLKLCPAAEQVSPAGAPYGTRWAFQV 107

  Fly   269 ---SQNGAHGHG---------------------------------GGNGQGNASA---------- 287
               |.:.|...|                                 ||:.:..||:          
Human   108 LSPSADSARLPGRAPGDRDCTFQPSAPAPSKPFLLSTPPFYSACCGGSCRRPASSTAFPREESML 172

  Fly   288 -----GSNGKRKRS-WSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNR 346
                 .||.|.:|. ..|||||..|||.||..||:||||:|.||:|||..|.|.::|||:|||||
Human   173 PLLTQDSNSKARRGILRRAVFSEDQRKALEKMFQKQKYISKTDRKKLAINLGLKESQVKIWFQNR 237

  Fly   347 RMKWRHTREN--------LKSGQEKQPSAVPESGGVFKTSTPSGDGTPQE 388
            |||||:::|.        .:.|.::.|.:....|  |.:..||....||:
Human   238 RMKWRNSKEKEVLSNRCIQEVGLQEDPLSRSALG--FPSPCPSIWDVPQQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 35/52 (67%)
DBX2NP_001004329.2 Homeobox 189..242 CDD:278475 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..318 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.