DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and sv

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster


Alignment Length:237 Identity:53/237 - (22%)
Similarity:85/237 - (35%) Gaps:53/237 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 QHQQHHHH-------QHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQ---LTQQQQRFLGKT 249
            |...||.|       ||...|.|..|........|::..|.  |....||   ||..||:.:..|
  Fly     7 QTSTHHIHGLGTHELQHRILHPHILHSTQEETLNTSTGQLE--HDSQHLQQHHLTHHQQQDVSPT 69

  Fly   250 PQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQF 314
            ...|.:.......:....|:|| .|||       ...:|||          ::::.|   :|.:.
  Fly    70 LHNLQNTRTGDSLSTTINTNQN-QHGH-------QHLSGSN----------MYTSSQ---MEDKS 113

  Fly   315 QQQKYITKPDRRKLAARLNLTDAQV-----KVWFQNRRMKWRHTRENLKSGQEKQPSA------- 367
            :..||    |........|::||..     ....|::.::|.....::::|.|...|:       
  Fly   114 KANKY----DEYSSRTLSNISDANTTPSANNFITQSQGIEWITAMNDIQNGAEDSHSSQGSISGD 174

  Fly   368 ----VPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQ 405
                |.:.||||....|..|...|..::.:.:.....|:|.|
  Fly   175 GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQ 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 9/57 (16%)
svNP_524633.3 PAX 175..299 CDD:128645 11/42 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.