DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Ptx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster


Alignment Length:271 Identity:69/271 - (25%)
Similarity:101/271 - (37%) Gaps:85/271 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 APTYPTLATNALLRFHQHQKQQ-----HQQHHHHQHHPKHLHQQHKP--------------PPHN 219
            :|...:|...:.|....|...|     :.||.||...|.|. .:|:|              ..|:
  Fly   127 SPAISSLMPISSLSHLHHSAGQDLVGGYSQHPHHTVVPPHT-PKHEPLEKLRIWAETGDFRDSHS 190

  Fly   220 STTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGH-------- 276
            |.||.|     :||.|..|...|                ||..::.:..|::...|:        
  Fly   191 SMTAVA-----NSLDSTHLNNFQ----------------TSSTSSISNRSRDRKDGNRSVNETTI 234

  Fly   277 ------GGGNGQGNASAG------SNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLA 329
                  ..|:.:...::|      ...||:|. .|..|::.|.:.||..|.:.:|.....|.::|
  Fly   235 KTENISSSGHDEPMTTSGEEPKNDKKNKRQRR-QRTHFTSQQLQELEHTFSRNRYPDMSTREEIA 298

  Fly   330 ARLNLTDAQVKVWFQNRRMKWRHTREN----------LKSG---QEKQP-------SAVPESGGV 374
            ...|||:|:|:|||:|||.|||....|          .|||   |..||       |:.|.:.. 
  Fly   299 MWTNLTEARVRVWFKNRRAKWRKRERNAMNAAVAAADFKSGFGTQFMQPFADDSLYSSYPYNNW- 362

  Fly   375 FKTSTPSGDGT 385
              |..||..||
  Fly   363 --TKVPSPLGT 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 21/52 (40%)
Ptx1NP_001138130.2 Homeobox 268..320 CDD:278475 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.