DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and lbe

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster


Alignment Length:407 Identity:102/407 - (25%)
Similarity:146/407 - (35%) Gaps:104/407 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HESAASMEQSMPENLSTHMYGECEVNPTLAKCPDPVNVDHELPTKESCASTTIV---STSPTSA- 64
            |.:||:...:....|:....|..           |.:..|.|......:|::..   :.||.|| 
  Fly    62 HAAAAAAAAAAASGLTRSAVGNL-----------PEDYFHPLKRLRMSSSSSEPRDHTPSPPSAV 115

  Fly    65 -----TSTTKVKL----SFSVDRLLGSEPEESHRQSSSSPSTKSCCDGSILACCSFPHCFSQANA 120
                 ..|||..:    |||:..:||.  .|..|:.|.||.               |:....|..
  Fly   116 PEPQTNQTTKSAIEGVKSFSIADILGH--SEKQREESVSPP---------------PNANLLAPP 163

  Fly   121 ESRRFGHA--TLPPTFTPTSSHTYPFVGLDKLFPGPYM--DYKSVLRPT-PIRAAEHAAPTYPTL 180
            .||....:  .|.|...|...|  |......|.|...:  .:..:|.|| |:|      |..|  
  Fly   164 ASRPIAPSGGLLQPRTEPLDVH--PAAAAAMLLPSGQIVRPWDHLLGPTMPVR------PFIP-- 218

  Fly   181 ATNALLRFHQH-QKQQHQQHHHHQHHPKHL--HQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQ 242
              :|||.:.|. ....|:|...|.:....|  |....|         |::|....  |.:.:|:.
  Fly   219 --SALLHYEQRLALDYHRQLQEHFNAQAQLLRHMGMNP---------AIIASEDG--SSERSQRS 270

  Fly   243 QRFLGKT----PQQL--LDIAPTSPAAAAAATSQNGAHGHGGGNGQGNA---------------- 285
            ....|.|    |:|.  |:...|...:..|...::.....|.|...|:.                
  Fly   271 SSSNGSTECCSPRQAEKLEKLTTQEGSEEAQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFDES 335

  Fly   286 ---------SAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKV 341
                     |.....|:||. ||..|:|.|...||.:|..|||::..||.::||.|.|::|||..
  Fly   336 QDKSHLDIFSNRPQPKKKRK-SRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVIT 399

  Fly   342 WFQNRRMKWRHTRENLK 358
            ||||||.|.:...|.||
  Fly   400 WFQNRRAKQKRDIEELK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/52 (52%)
lbeNP_524435.2 Homeobox 356..410 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.