DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and lbl

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster


Alignment Length:435 Identity:100/435 - (22%)
Similarity:154/435 - (35%) Gaps:109/435 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KCPDPVNVDHELPTKESCASTTIVSTSPTSATSTTKVKLSFSVDRLLGSEPEESH-RQSSSSPST 97
            :.|.|.|.|           .::.|.||....|....:|     |||.|.....| ||.||....
  Fly     4 RTPSPANSD-----------VSVGSPSPPPLRSLNMKRL-----RLLRSPISLEHDRQKSSPVRV 52

  Fly    98 KSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPGPYMDYKSVL 162
            ||               ||.|:...|  ||........|..      :.:....||.        
  Fly    53 KS---------------FSIADILGR--GHEEDRVEKKPER------IAIPNALPGV-------- 86

  Fly   163 RPTPI-----RAAEHAAPTYP------TLATNALLRFHQHQKQ-----QHQQHHHHQHHPKHLHQ 211
             |.|:     |......|..|      |..:.|||  |.::::     |.|...|.|...:.|.|
  Fly    87 -PAPLALINERLQIPLVPNCPPPAALHTFLSPALL--HSYEQRLAWDYQRQLQEHFQAQAQLLRQ 148

  Fly   212 QHKPP-----PHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQN 271
            ....|     ...|:..|...:..:..|......|.::...::.:..:::...||.......|::
  Fly   149 MTLNPAIIASEDGSSERSQRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKS 213

  Fly   272 GAHGHGGGNGQGNA---------------------SAGSNGKRKRSWSRAVFSNLQRKGLEIQFQ 315
                  .|:...:|                     :..||.|:||. ||..|:|.|...||.:|.
  Fly   214 ------SGDTPLDALFQLSTKNFDEEQDPATLNIFATRSNPKKKRK-SRTAFTNQQIFELEKRFL 271

  Fly   316 QQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTP 380
            .|||::..||.::|..|.|::|||..||||||.|.:...|.||  ::.|...:|:.......|..
  Fly   272 YQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEELK--KDVQCEKIPDQSADPNRSHH 334

  Fly   381 SGDGTPQEALDYS------SDSCSSVDLSEQADED-DNIEINVVE 418
            :.....|:...|:      ||.....|...:.::| |..|:.:::
  Fly   335 NHPHYHQQHQHYAHMQSIGSDRDMDKDRCREKEKDKDKEELRMLK 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 26/52 (50%)
lblNP_001262805.1 COG5576 206..332 CDD:227863 39/134 (29%)
Homeobox 254..307 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.