DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and CG15696

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster


Alignment Length:192 Identity:48/192 - (25%)
Similarity:72/192 - (37%) Gaps:55/192 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 LATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQH--KPPPHNSTTASALLAPLHSLTSLQLTQQQ 242
            :.|||.|...|..:.. ...|.:.|...::.::.  .||      |||..|.:.....||.|:..
  Fly    18 VGTNASLGVLQRLRAS-LPFHPYAHPASYVSKESGGSPP------ASAAEAQIPVYDWLQYTRYH 75

  Fly   243 QRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRS---WSRAVFSN 304
            .   .|.|:.|...||.                                  ||:   ..|..|:.
  Fly    76 P---PKLPRALRQNAPA----------------------------------KRTPGRLPRIPFTP 103

  Fly   305 LQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPS 366
            .|.:.||..:::..|::..|..|||..|.||:.:||:||||||.:.|..:      :||..|
  Fly   104 QQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREK------REKDES 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 21/52 (40%)
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 17/46 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I3229
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.