DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and MEOX1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_004518.1 Gene:MEOX1 / 4222 HGNCID:7013 Length:254 Species:Homo sapiens


Alignment Length:331 Identity:82/331 - (24%)
Similarity:112/331 - (33%) Gaps:121/331 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PSTKSCC-----DGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPGP 154
            |:..||.     ...:..|...||  |:.|      |.:.||        | ||           
Human     3 PAASSCMRSLQPPAPVWGCLRNPH--SEGN------GASGLP--------H-YP----------- 39

  Fly   155 YMDYKSVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHN 219
                     |||.  :.|..|.:...||.|...|                               
Human    40 ---------PTPF--SFHQKPDFLATATAAYPDF------------------------------- 62

  Fly   220 STTASALLAPLHSLTSLQ--LTQQQQRFLGKTPQQLLDIA-----PTSPAAAAA---ATSQNGAH 274
              :||.|.|..|||...:  .|:|...| .::|.....::     |.|..|..:   .||..|..
Human    63 --SASCLAATPHSLPQEEHIFTEQHPAF-PQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLV 124

  Fly   275 GHGGGNGQGNASAGS--------------------------NGKRKRSWSRAVFSNLQRKGLEIQ 313
            ...||.|......||                          .|..|....|..|:..|.:.||.:
Human   125 DTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAE 189

  Fly   314 FQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAV-PESGGVFKT 377
            |....|:|:..|.::|..|:|::.|||||||||||||:    .:|.||...|:.. ||.|.  .|
Human   190 FAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWK----RVKGGQPISPNGQDPEDGD--ST 248

  Fly   378 STPSGD 383
            ::||.:
Human   249 ASPSSE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/52 (46%)
MEOX1NP_004518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..178 16/92 (17%)
Homeobox 175..227 CDD:306543 24/51 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..254 10/32 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.