DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and CG18599

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster


Alignment Length:399 Identity:86/399 - (21%)
Similarity:126/399 - (31%) Gaps:160/399 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 HAAPTYPTLATNALL-----------------RFHQ-HQKQQHQQHHHHQH-HPKHL--HQQHKP 215
            |..|.:..||..|..                 :.|| .|:||.|||||||. |..|.  |..|.|
  Fly    48 HGQPHHAALAAAAAAAVAVSAGQSSYQMEHQQQHHQLQQQQQQQQHHHHQQLHTHHQDGHHPHPP 112

  Fly   216 PP----HNSTTASALLAPLHSLTS----------LQLTQQQQRFLGKTPQQLLDIAPTSPAAA-- 264
            .|    :|:.::|:..:..|:..|          ...|...|..........||:..:...||  
  Fly   113 TPTTGNNNNNSSSSSNSSSHNSNSNHREQLAAAAATATSHAQLIEAAAAHSSLDVGKSFTIAAIL 177

  Fly   265 --------------------------------AAATSQNGAHGHGGGNGQGN------------A 285
                                            .:..:.|..:.:.||:..||            .
  Fly   178 GLQSQRKDYNNAINLSLHDNNNIIGDDNNKCYTSNPNNNNNNNNNGGSNSGNNNSSPSVNNFNCD 242

  Fly   286 SAGSNG----------------------------------------------------------- 291
            |...||                                                           
  Fly   243 SVAGNGRYLHGGHQHPHPHQAGFAAVAAAVGAAPSALQSLQQLHQQHHAQQQATLSFQREKLKSD 307

  Fly   292 -------KRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMK 349
                   |.||  .|.:|:..|.:.||.:|::|:|:..|:|..||..|.||:|||||||||||:|
  Fly   308 SHKKSALKNKR--VRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIK 370

  Fly   350 WRH-----TRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCS--SVDLSEQAD 407
            ||.     |::.|...::.|.......|.....|..:......|    .::.||  |..|.|:.:
  Fly   371 WRKHHLELTQQRLALIRQTQLPGTSLLGNQVSVSANAAHSVSTE----RTNGCSAASPSLQEEDN 431

  Fly   408 EDDNIEINV 416
            ||....:::
  Fly   432 EDSKHSLSL 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/52 (52%)
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.