DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and NK7.1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster


Alignment Length:477 Identity:102/477 - (21%)
Similarity:169/477 - (35%) Gaps:164/477 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PENLSTHMYGECEVNPTLAKCPDPVNVDHELPTKESCASTTIVSTSPTSATSTTKVKLSFSVDRL 79
            |.:::|||     |:|........||:   |..:::....:.:|.||.:..      |...::.:
  Fly    84 PTSMTTHM-----VSPIGNSKEKLVNM---LRVRDNNNMASTISDSPPTTF------LQKQLEAV 134

  Fly    80 LGSEPEESH----------------RQSSSSPSTKSCCDGSILACCSFPHCFSQANAESRRFGHA 128
            :...|...|                |:|.|:|:         :.....|.....|:...|     
  Fly   135 VAPRPSSVHPQHQQPQQQTVQLQQQRRSVSTPA---------ITTTPGPPTNWHAHVYDR----- 185

  Fly   129 TLPPTFTPTS----------SHTYPFVGLDKLFPGPYMDYKSVLRP----TPIRAA--------- 170
             |||..||.|          ....|.|..|.  .||.....|:|:|    .|||::         
  Fly   186 -LPPHPTPHSIADILGMSFVKKERPEVAFDA--QGPAKSPNSILKPYQEQQPIRSSSISMSDASE 247

  Fly   171 -EHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLT 234
             |.||....|.|..|......                             :.||:.:..||....
  Fly   248 EESAAVAGATSAATAAAAVAA-----------------------------TITAATVATPLDQPL 283

  Fly   235 SLQLTQ-------------QQQRFLGKTPQQL--------------------LDIAPT------- 259
            :|.:.:             :|.:.|||:..:.                    .||:||       
  Fly   284 NLCVVKKSRDSNNSPMPATKQSQILGKSATKKESSGKPAAKKKKLSSTVALPPDISPTGSSDSLM 348

  Fly   260 ----------SPAAAAAATSQNGAHGHGGGNG-----QGNASAGSNGKRKRSWSRAVFSNLQRKG 309
                      ||.:...|..|:.|      |.     :.::.:||...|::..:|..|:..|...
  Fly   349 RDKLMANNSSSPGSNVNAQMQSNA------NSTLETTEDDSDSGSTDARRKKKARTTFTGRQIFE 407

  Fly   310 LEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRE--NLKSGQEKQPSAVPESG 372
            ||..|:.:||::..:|.::|..|.:|:.|||:||||||.||:....  |.::.:.|..:|.|.:.
  Fly   408 LEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNNEAAEHKSSNAKPGAT 472

  Fly   373 GVFKTSTPSGDGTPQEALDYSS 394
            |. .|:||||:.|.:.:.:.:|
  Fly   473 GT-ATTTPSGEPTDKRSSNATS 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.