DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Poxm

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster


Alignment Length:124 Identity:32/124 - (25%)
Similarity:43/124 - (34%) Gaps:33/124 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 HQHQKQQHQQ-------HHHHQHHPKHLHQQHK-PPPHNSTTASALLAPLHSLTSLQLTQQQQRF 245
            |.|....||.       ||.|.|...|.|..:. ..|:::..|.::..|..|.:..|....|   
  Fly   190 HPHHHHHHQSAAAAASAHHVHAHAHAHAHLYNSIYQPYSAAAAYSMKTPCGSPSPPQGAGGQ--- 251

  Fly   246 LGKT--PQQLLDIAPTSPAA------------------AAAATSQNGAHGHGGGNGQGN 284
             |..  |.||..:|..:.||                  |..|:.|.|. |.||..|.|:
  Fly   252 -GSVPHPHQLRSVAAAAAAAHWPSSHSVSDILAHHQAVALRASCQVGV-GVGGMGGMGS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475
PoxmNP_001036687.1 PAX 10..133 CDD:128645
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.