DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Scr

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:273 Identity:68/273 - (24%)
Similarity:95/273 - (34%) Gaps:102/273 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 YPTLATNALLRFHQHQKQQHQQHHH--------------HQHHPKHLHQQHK----------PPP 217
            |..|....|| ..|.|:||.|||.|              .|.||:...||.:          |..
  Fly   112 YTQLQPQRLL-LQQQQQQQQQQHAHAAAAVAAQQQQQLAQQQHPQQQQQQQQANISCKYANDPVT 175

  Fly   218 HNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQL--LDIAP-TSP------------------ 261
            ...:....:....::..|........:.|. :||.|  .||:| .||                  
  Fly   176 PGGSGGGGVSGSNNNNNSANSNNNNSQSLA-SPQDLSTRDISPKLSPSSVVESVARSLNKGVLGG 239

  Fly   262 --AAAAAATSQNGAHGHGG------------------------------------GNGQ------ 282
              ||||||...|..|...|                                    |||:      
  Fly   240 SLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQI 304

  Fly   283 ---------GNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQ 338
                     |.::..:||:.||  .|..::..|...||.:|...:|:|:..|.::|..|.||:.|
  Fly   305 YPWMKRVHLGTSTVNANGETKR--QRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQ 367

  Fly   339 VKVWFQNRRMKWR 351
            :|:|||||||||:
  Fly   368 IKIWFQNRRMKWK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.