DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Dfd

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster


Alignment Length:384 Identity:86/384 - (22%)
Similarity:133/384 - (34%) Gaps:121/384 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SHRQSSSSP--STKSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPFVGLDK 149
            ||..:.|.|  .:.|...|         |..:.|...|..:.:|| ||:...:..|.:|...|  
  Fly   100 SHSHTHSLPHHHSNSAISG---------HHQASAGGYSSNYANAT-PPSHPHSHPHAHPHQSL-- 152

  Fly   150 LFPGPYMDYKSVLRPTPIRA-AEHAAPT--YPTLA-------------TNALL------------ 186
               |.|:.:    .|..|.| |.|:.||  |...|             :.|:|            
  Fly   153 ---GYYVHH----APEFISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGY 210

  Fly   187 ---------RFHQHQKQQHQQHH--HHQHHPKHLHQQHKPPPHNSTTASAL-------------L 227
                     ..:......|.|.|  |.|.....|......||.|  ||..|             .
  Fly   211 YGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTN--TALGLQELGLKLEKRIEEA 273

  Fly   228 APL-HSLTSL--------------QLTQQQQRFLGKTPQQL------LDIAPTSPAAAAAATSQN 271
            .|. ..|..|              .::::.:..|.::|.:|      .|:..:.......|.:.:
  Fly   274 VPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTD 338

  Fly   272 GAH--------GHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKL 328
            |..        .|..|...|:...|...||:|:    .::..|...||.:|...:|:|:..|.::
  Fly   339 GERIIYPWMKKIHVAGVANGSYQPGMEPKRQRT----AYTRHQILELEKEFHYNRYLTRRRRIEI 399

  Fly   329 AARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGV-FKTSTPSGDGTP 386
            |..|.|::.|:|:|||||||||            |:.:.:|.:..| .||...:|:.||
  Fly   400 AHTLVLSERQIKIWFQNRRMKW------------KKDNKLPNTKNVRKKTVDANGNPTP 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 20/52 (38%)
DfdNP_477201.1 Homeobox 370..422 CDD:278475 22/67 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.