DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and zen2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:134 Identity:47/134 - (35%)
Similarity:63/134 - (47%) Gaps:35/134 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 ASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMK 349
            |:..|:.|.||  ||..||:||...||.:|...||:.:..|.:::.||.||:.|||:||||||||
  Fly    35 ATTRSSEKSKR--SRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMK 97

  Fly   350 WRHTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQADEDDNIEI 414
            .:      ||...|  .|:    |...||.|                     ||.|:.||...:.
  Fly    98 LK------KSTNRK--GAI----GALTTSIP---------------------LSSQSSEDLQKDD 129

  Fly   415 NVVE 418
            .:||
  Fly   130 QIVE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/52 (52%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.