DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and pb

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster


Alignment Length:231 Identity:64/231 - (27%)
Similarity:92/231 - (39%) Gaps:67/231 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LGKTPQ--QLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRK 308
            :|..||  ..:|..|..|......||:..::.:..|:.........||..:|  .|..::|.|..
  Fly   149 VGVVPQTPDGMDSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRR--LRTAYTNTQLL 211

  Fly   309 GLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLK-----------SGQE 362
            .||.:|...||:.:|.|.::||.|:||:.||||||||||||  |.|:.|.           .|.:
  Fly   212 ELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMK--HKRQTLSKTDDEDNKDSLKGDD 274

  Fly   363 KQ---------------------PSAVPESGGVFKTSTPS--------GDGTPQEALD------- 391
            .|                     |.:...|.| ...:|||        |:.||..:|:       
  Fly   275 DQSDSNSNSKKSCQGCELPSDDIPDSTSNSRG-HNNNTPSATNNNPSAGNLTPNSSLETGISSNL 338

  Fly   392 -----------YSSDS--CSSVDLSEQADEDDNIEI 414
                       .|:||  .|||.|.|..:|...|::
  Fly   339 MGSTTVSASNVISADSSVASSVSLDEDIEESSPIKV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/52 (52%)
pbNP_476669.3 COG5576 168..274 CDD:227863 37/109 (34%)
Homeobox 202..254 CDD:278475 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.