Sequence 1: | NP_523488.2 | Gene: | H2.0 / 33841 | FlyBaseID: | FBgn0001170 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_476669.3 | Gene: | pb / 40826 | FlyBaseID: | FBgn0051481 | Length: | 782 | Species: | Drosophila melanogaster |
Alignment Length: | 231 | Identity: | 64/231 - (27%) |
---|---|---|---|
Similarity: | 92/231 - (39%) | Gaps: | 67/231 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 246 LGKTPQ--QLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRK 308
Fly 309 GLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLK-----------SGQE 362
Fly 363 KQ---------------------PSAVPESGGVFKTSTPS--------GDGTPQEALD------- 391
Fly 392 -----------YSSDS--CSSVDLSEQADEDDNIEI 414 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
H2.0 | NP_523488.2 | Homeobox | 298..351 | CDD:278475 | 27/52 (52%) |
pb | NP_476669.3 | COG5576 | 168..274 | CDD:227863 | 37/109 (34%) |
Homeobox | 202..254 | CDD:278475 | 27/53 (51%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 53 | 1.000 | Domainoid score | I4196 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D858478at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |