DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and si:dkey-43p13.5

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_002661267.2 Gene:si:dkey-43p13.5 / 407678 ZFINID:ZDB-GENE-131121-510 Length:315 Species:Danio rerio


Alignment Length:337 Identity:71/337 - (21%)
Similarity:104/337 - (30%) Gaps:143/337 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SPSTKSCCDGSILACC----------SFPHC-----FSQANAESRRFGHAT---LPPTFTPTSSH 140
            |...|....|.:|..|          ..|.|     :|..|......||..   .|..|...::|
Zfish    15 SIKAKPVLPGLVLMACEDLQEVLLPAGSPQCLELFFWSLLNLVMFGAGHLVSPLSPAVFHSPAAH 79

  Fly   141 TYPF----VGLDKLF-PGPYMDY---KSVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQ 197
            .:|.    :...::| |||.:.|   :|.|:|.|.:                             
Zfish    80 FFPAFPSRLSSPQIFIPGPLLSYELLRSYLQPEPCK----------------------------- 115

  Fly   198 QHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPA 262
                                      .:||...|                          |:|  
Zfish   116 --------------------------QSLLLAAH--------------------------PSS-- 126

  Fly   263 AAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD--- 324
                            |:...|.......|::|  :||.:|:.|.:.||..||...|   ||   
Zfish   127 ----------------GHPADNIDEPRPVKQRR--ARANYSSWQLEELEKTFQSTHY---PDIFM 170

  Fly   325 RRKLAARLNLTDAQVKVWFQNRRMKW-RHTRENLKSG----QEKQPSAVPESGGVFKTSTPS-GD 383
            |..||.||:|.:|:|:|||||||.|. |..:..:::|    |....:..|||    ..|.|. .:
Zfish   171 REALALRLDLIEARVQVWFQNRRAKMRRQLKLQIQTGEQCSQRDTDTRHPES----SISNPELHN 231

  Fly   384 GTPQEALDYSSD 395
            .:|....|.:.|
Zfish   232 NSPSPCWDRNQD 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/56 (48%)
si:dkey-43p13.5XP_002661267.2 Homeobox 145..197 CDD:278475 27/54 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.