DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and irx5b

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001001405.1 Gene:irx5b / 405792 ZFINID:ZDB-GENE-040628-5 Length:371 Species:Danio rerio


Alignment Length:184 Identity:48/184 - (26%)
Similarity:71/184 - (38%) Gaps:48/184 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 SPAAAAAATSQNGA--------------HGHGGGNGQ---GNASAGSNGKRKRSWSRAVFSNLQR 307
            ||.:||..||..|:              |.:.|..|.   |:.:...|..|..:.:...:.|..|
Zfish    64 SPESAAPFTSYGGSPYDPSPGMTGSIGYHPYAGPLGPYPFGDPAYRKNATRDATATLKAWLNEHR 128

  Fly   308 KGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQN--RRMKWRHTREN-------LKSGQEK 363
            |        ..|.||.::..||....:|..||..||.|  ||:|    :||       .:|..|.
Zfish   129 K--------NPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK----KENKMTWTPRTRSEDED 181

  Fly   364 QPSAV-----PESGGVFKTSTPSGDG-TPQEALDYSSDSCSSVDLSEQADEDDN 411
            :..::     .|.....||:..:.|. |..|..|.|:||. .:|..|   |::|
Zfish   182 EEDSIDLEKNDEDDEPMKTAESTKDSETRAEDHDDSTDSV-IIDCGE---EEEN 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 17/54 (31%)
irx5bNP_001001405.1 Homeobox_KN 123..162 CDD:283551 14/46 (30%)
IRO 267..284 CDD:214716
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.