DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and hhex

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_989420.1 Gene:hhex / 395060 XenbaseID:XB-GENE-487159 Length:274 Species:Xenopus tropicalis


Alignment Length:266 Identity:67/266 - (25%)
Similarity:94/266 - (35%) Gaps:88/266 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 HNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDI--------------APTSPAAAAAAT 268
            |.|::|..|..||::.|.||...       .||..:.||              .||.|:..::.|
 Frog     5 HPSSSALGLSVPLYAPTPLQPVH-------PTPFYIDDILGRSSASNGTPALPTPTLPSPNSSFT 62

  Fly   269 SQNGAHG---------HGGGNGQGNASAGSNGK-------------------------------- 292
            |....:.         |......|.|.|.|.|.                                
 Frog    63 SLVATYRTPIYEPTPIHPAFTHPGAALAASYGASTYANPLYPFSRPVSEYTHALIRHDTLGKPLL 127

  Fly   293 ---------RKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRM 348
                     .||...:..|||.|...||.:|:.|||::.|:|::||..|.|::.|||.||||||.
 Frog   128 WSPFIQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRA 192

  Fly   349 KWRHTRENLKSGQEKQPS---------------AVPESGGVFKTSTPSGDGTPQEALD--YSSDS 396
            |||..::....|.:|..:               :..:.........|:...|.||.||  .|.||
 Frog   193 KWRRLKQENPQGNKKDETESLENICEESQERCLSAEQKSRESSLDEPTSSPTSQETLDSEVSDDS 257

  Fly   397 CSSVDL 402
            ...||:
 Frog   258 DQEVDI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 26/52 (50%)
hhexNP_989420.1 Homeobox 145..195 CDD:278475 26/49 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..274 13/67 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.