DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and eyg

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster


Alignment Length:474 Identity:99/474 - (20%)
Similarity:142/474 - (29%) Gaps:156/474 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PDPVNVDHELPTKESCASTTIVSTSPTSA----------------------TSTTKVKL--SFSV 76
            |.|..:....|...|.|:.::.:.:..:|                      ||.|.|::  .|..
  Fly    30 PHPQRITSLAPHASSVAAASVAAAAAAAAAAAAAAAGAGSGAVAGGGGATSTSPTSVQIPPGFGG 94

  Fly    77 DRLLGSEPEESHRQSSSSPSTKSCCDGSILACCSF---------PHCFSQANAESRRFGH----- 127
            ....|..|..:...:.|:.:| ......:|....|         .|..:|..|.|:..|.     
  Fly    95 GGSTGGIPHGAGGPTGSTLNT-LMSQHRLLEFSRFGGLRGYDIAQHMLTQQGAVSKLLGSLRPPG 158

  Fly   128 ---ATLPPTFTPT------------------------------SSHTYPFVGLDKLFPGPYMDYK 159
               .:.|...|||                              ::.|.|.|             .
  Fly   159 LIGGSKPKVATPTVVSKIEQYKRENPTIFAWEIRERLISEGVCTNATAPSV-------------S 210

  Fly   160 SVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHL-HQQHKPPPHNSTTA 223
            |:.|....||||..|..:...|...|     :....|.......|...:: ..|..|||...:..
  Fly   211 SINRILRNRAAERVATEFARTAAYGL-----YPPPPHPYGSFTWHPAGNVPGGQGVPPPPPPSAL 270

  Fly   224 SALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSP----------AAAAAATSQNGAHGHGG 278
            .::.||.               |...|.......|.|.          |..|..|..|.|...|.
  Fly   271 WSVAAPT---------------LANLPPSAASAVPVSTCGSLSSAHLMAGGAGGTPTNRAISPGS 320

  Fly   279 GNGQGNASAGSN-----------GKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARL 332
            |:.....||..|           .:.|...:|..||..|.:.||.:|.:..|.....|.:|::|.
  Fly   321 GSHDTLESADENRHIDSDYLDDDDEPKFRRNRTTFSPEQLEELEKEFDKSHYPCVSTRERLSSRT 385

  Fly   333 NLTDAQVKVWFQNRRMKW-RHTRENLKSGQEKQP---------------SAVPESGGVFKTSTP- 380
            :|::|:|:|||.|||.|| ||.|.||...|...|               |..|.:.....||.| 
  Fly   386 SLSEARVQVWFSNRRAKWRRHQRMNLLKRQRSSPANPLHSQQSNDAPASSPTPSNHSSASTSAPV 450

  Fly   381 ------------SGDGTPQ 387
                        .||.:||
  Fly   451 APVPPPQQPLPLCGDHSPQ 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/53 (42%)
eygNP_001014582.1 HTH 120..217 CDD:304362 16/109 (15%)
Homeobox 352..404 CDD:278475 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.