DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and toe

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster


Alignment Length:516 Identity:109/516 - (21%)
Similarity:157/516 - (30%) Gaps:211/516 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IVSTSPTSATSTTKVKLSFSVDRLL---GSEPEES------HRQSSSSPSTKSCCDGSILACCS- 110
            |...|||:||:......|.|....:   |:.|..:      ...:::.|...:....::.|..| 
  Fly    69 ITPVSPTAATTVLAQPHSLSPSTPILTQGAPPAAALGGIFCGGSAAAGPGAAAAAATNLNALASQ 133

  Fly   111 ----------------FPHCFSQANAESRRFGHATL----------PPTFTPT------------ 137
                            ..|..||..|.|:..|  ||          |...|||            
  Fly   134 HRLLELSRFGLRGYDLAQHMLSQQGAVSKLLG--TLRPPGLIGGSKPKVATPTVVSKIEQYKREN 196

  Fly   138 ------------------SSHTYPFVGLDKLFPGPYMDYKSVLRPTPIRAAEHAAPTYPTLATNA 184
                              ::.|.|.|             .|:.|....||||.||..:...|:  
  Fly   197 PTIFAWEIRERLITEGVCTNATAPSV-------------SSINRILRNRAAERAAAEFARAAS-- 246

  Fly   185 LLRFHQHQKQQHQQHHHHQHHPKHLH--------QQHKP---------PPHNSTT-ASALLAPLH 231
                           :.:..||.|.|        ..|.|         ||..... |...|.|..
  Fly   247 ---------------YGYAIHPTHPHPYTSFPTWPAHHPLWGAVPLATPPGGGPAGAGGALQPGG 296

  Fly   232 SLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGS------- 289
            |.:|........               ::|.::.:.|:.:..|....|:|.|::||||       
  Fly   297 SGSSYGSDGNMS---------------SNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPA 346

  Fly   290 ----NGKR----------------------------KRSWSRAVFSNLQRKGLEIQFQQQKYITK 322
                :|.|                            |...:|..||..|...||.:|.:..|...
  Fly   347 LSPDSGSRDSRSPDADANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCV 411

  Fly   323 PDRRKLAARLNLTDAQVKVWFQNRRMKW-RHTRENL----------------------------- 357
            ..|.|||||..|::|:|:|||.|||.|| ||.|.||                             
  Fly   412 NTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPV 476

  Fly   358 -------KSGQEKQPSAVPESGGVFKTSTPSGDGTPQEALD---YSSDSCSSVDLSEQADE 408
                   :|||:|||.....| .:..||:.|.:..|...::   ..|...|||..::..:|
  Fly   477 PVPVAVPESGQQKQPYPYSTS-NMCNTSSSSSNSQPCNTINPGSKMSSKTSSVSSNQHMEE 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/53 (47%)
toeNP_524041.2 HTH 134..230 CDD:304362 17/110 (15%)
Homeobox 388..440 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.