DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and BSX

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001091639.1 Gene:BSX / 390259 HGNCID:20450 Length:233 Species:Homo sapiens


Alignment Length:273 Identity:71/273 - (26%)
Similarity:106/273 - (38%) Gaps:107/273 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 RPTPIR--AAEHAAPT-----------YPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHK 214
            :|.|:|  |.:|.|.:           ||.:.|..||..|.|    |..|....|||..|.....
Human    29 KPKPLREVAPDHFASSLASRVPLLDYGYPLMPTPTLLAPHAH----HPLHKGDHHHPYFLTTSGM 89

  Fly   215 PPPHNSTTASALLA-PLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGG 278
            |.|       ||.. |.|:               :.|                            
Human    90 PVP-------ALFPHPQHA---------------ELP---------------------------- 104

  Fly   279 GNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWF 343
                     |.:.:|::  :|.|||:.|..|||.:|:.|:|::.|:|.:||..|:|::.|||.||
Human   105 ---------GKHCRRRK--ARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWF 158

  Fly   344 QNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVD------- 401
            ||||||  |.::..||..|.:....||          |.:|:|:     .|::.::.:       
Human   159 QNRRMK--HKKQLRKSQDEPKAPDGPE----------SPEGSPR-----GSEAATAAEARLSLPA 206

  Fly   402 ----LSEQADEDD 410
                |:|..||.|
Human   207 GPFVLTEPEDEVD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 28/52 (54%)
BSXNP_001091639.1 Homeobox 114..166 CDD:278475 28/53 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..233 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.