DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and gsb

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster


Alignment Length:162 Identity:53/162 - (32%)
Similarity:72/162 - (44%) Gaps:30/162 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 SPAAAAAATSQNGAHGHG------GGNGQGNASAGSNG------------KRKRSWSRAVFSNLQ 306
            :|:.::.:....|:.|.|      |..|.|..|.||..            |||:..||..|||.|
  Fly   132 APSVSSISRLLRGSSGSGTSHSIDGILGGGAGSVGSEDESEDDAEPSVQLKRKQRRSRTTFSNDQ 196

  Fly   307 RKGLEIQFQQQKYITKPD---RRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAV 368
            ...||..|.:.:|   ||   |.:||....||:|:|:|||.|||.:   .|:.|.:  ::.||..
  Fly   197 IDALERIFARTQY---PDVYTREELAQSTGLTEARVQVWFSNRRAR---LRKQLNT--QQVPSFA 253

  Fly   369 PESGGVFKTSTPSGDGTPQEALD-YSSDSCSS 399
            |.|.....|.|.|....|...:. |||.|..|
  Fly   254 PTSTSFGATPTTSAAPAPNMGMSLYSSQSWPS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/55 (45%)
gsbNP_523863.1 PAX 19..143 CDD:128645 1/10 (10%)
homeodomain 186..243 CDD:238039 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.