DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Alx3

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001007013.2 Gene:Alx3 / 365900 RGDID:1359270 Length:343 Species:Rattus norvegicus


Alignment Length:159 Identity:49/159 - (30%)
Similarity:67/159 - (42%) Gaps:47/159 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 AAAAAATSQ-----NGAHGHGGGNGQGNAS--------------------AGSNGKRKRSWSRAV 301
            |:.||:..|     .|....|..|.||:..                    |.|..|::|  :|..
  Rat    97 ASKAASFPQLPVDCRGGPRDGPSNVQGSPGPCLASLSVPLSPGLPDSMELAKSKSKKRR--NRTT 159

  Fly   302 FSNLQRKGLEIQFQQQKYITKPD---RRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEK 363
            ||..|.:.||..||:..|   ||   |.:||.|.:||:|:|:|||||||.|||         :.:
  Rat   160 FSTFQLEELEKVFQKTHY---PDVYAREQLALRTDLTEARVQVWFQNRRAKWR---------KRE 212

  Fly   364 QPSAVPESGGVFKTS-----TPSGDGTPQ 387
            :...:.|....|.|:     .|..|..||
  Rat   213 RYGKIQEGRNPFTTAYDISVLPRTDSHPQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/55 (49%)
Alx3NP_001007013.2 Homeobox 157..210 CDD:395001 29/64 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.