DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Barx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001102350.1 Gene:Barx1 / 364680 RGDID:1310884 Length:254 Species:Rattus norvegicus


Alignment Length:305 Identity:82/305 - (26%)
Similarity:113/305 - (37%) Gaps:97/305 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 SRRFGHATLPPT-FTPTSSHTYPFVGLDKLF---PGPYMDYKSVLRPTPIRAAEHAAPTYPTLAT 182
            |.|||    ||. ......|.|....::::.   |||                :.|||.....|.
  Rat     9 SARFG----PPEGCADHRPHRYRSFMIEEILTEPPGP----------------KGAAPAAAAAAA 53

  Fly   183 NALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLA--PLHSLTSLQLTQQQQRF 245
            ..||:|                                 ...||||  |.||  .|.:.:.:|..
  Rat    54 GELLKF---------------------------------GVQALLAARPFHS--HLAVLKAEQAA 83

  Fly   246 LGKTPQQLLDIAPTSPAAAAAATSQNGAHG----------HGGGNGQGNASAGSNGKRKRSWSRA 300
            :.|.|...|..:....|..||.....|..|          .|.....|:...|:..|:.|. ||.
  Rat    84 VFKFPLAPLGCSGLGSALLAAGPGMPGTAGTSHLPLELQLRGKLEAAGSGEPGTKAKKGRR-SRT 147

  Fly   301 VFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQP 365
            ||:.||..|||.:|::|||::.|||..||..|.|:..|||.|:|||||||:              
  Rat   148 VFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWK-------------- 198

  Fly   366 SAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQADEDD 410
            ..|.:.||:...:.|.  |.|::         :|:..|||..|.:
  Rat   199 KIVLQGGGLESPTKPK--GRPKK---------NSIPTSEQLTEQE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 30/52 (58%)
Barx1NP_001102350.1 Homeobox 145..198 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.