DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Rhox2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_017457588.1 Gene:Rhox2 / 363439 RGDID:1588607 Length:1162 Species:Rattus norvegicus


Alignment Length:288 Identity:63/288 - (21%)
Similarity:103/288 - (35%) Gaps:80/288 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 PPTFTPTSSHTYPFVGLDKLFPGPYMDYKSVLRPTPIR-AAEHAAP-------TYPTLATN---- 183
            |.|.|...:...|    .||...|:|...:. :|.|.| |.||..|       :.|...:|    
  Rat   913 PMTVTVLWAQPIP----AKLPRRPHMPMPAA-QPMPARVACEHPIPLPVPSVQSMPHSVSNMQPV 972

  Fly   184 ALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPP-----PHNSTTASALLAPLHSLTSLQLTQQQQ 243
            .:.|.|.......:.|    ..|..:.:.|..|     ||......|    :|.:.|::.|    
  Rat   973 PVTRPHSQPVPVTRPH----TQPVPVTRPHTQPVPVTRPHTQPVPVA----MHQVQSMRFT---- 1025

  Fly   244 RFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGH---------------GGGNGQGNASAGSNGKR 293
                ..|.|.|      |...::...:.||..|               ...|.|.....   ..|
  Rat  1026 ----VPPVQPL------PVMMSSVWPRPGAMPHVHPVPVMPCVQPIPVSASNVQPEPVL---VPR 1077

  Fly   294 KRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLK 358
            :....|  |::.:.:.||..||:..|::..:|::||..:.:::|:::.||:.||..:|..:.   
  Rat  1078 RHLHDR--FTDPELQELERVFQRNHYLSAEERKQLARGMGVSEAKLQRWFKKRREHFRREQS--- 1137

  Fly   359 SGQEKQPSAVPESGGVFKTSTP--SGDG 384
                       :|||....:||  |.||
  Rat  1138 -----------QSGGAPPGNTPPLSEDG 1154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 15/52 (29%)
Rhox2XP_017457588.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.