DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Lhx4

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001101818.2 Gene:Lhx4 / 360858 RGDID:1308044 Length:390 Species:Rattus norvegicus


Alignment Length:132 Identity:36/132 - (27%)
Similarity:59/132 - (44%) Gaps:21/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 NASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD---RRKLAARLNLTDAQVKVWFQN 345
            |..:.:..||.|       :.:..|.||......|...||.   |.:|::...|....|:|||||
  Rat   150 NDDSEAGAKRPR-------TTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQN 207

  Fly   346 RRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQADEDD 410
            ||.|.:..:::  :|:.:.       |..:|:...|..|:.||. :.|::.|...| ||.:..:|
  Rat   208 RRAKEKRLKKD--AGRHRW-------GQFYKSVKRSRGGSKQEK-ESSAEDCGVSD-SELSFRED 261

  Fly   411 NI 412
            .|
  Rat   262 QI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 18/55 (33%)
Lhx4NP_001101818.2 LIM1_Lhx4 30..81 CDD:188852
LIM2_Lhx3_Lhx4 89..144 CDD:188762
Homeobox 160..214 CDD:395001 19/60 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.