DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and eve

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:166 Identity:50/166 - (30%)
Similarity:72/166 - (43%) Gaps:40/166 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 HQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLD 255
            |..:.:....||.||......| ||                .:..|..||     .|| ||    
  Fly     2 HGYRTYNMESHHAHHDASPVDQ-KP----------------LVVDLLATQ-----YGK-PQ---- 39

  Fly   256 IAPTSP--AAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQK 318
            ..|.||  ..::...|.||:.|       ....|..:.:|.|:    .|:..|...||.:|.::.
  Fly    40 TPPPSPNECLSSPDNSLNGSRG-------SEIPADPSVRRYRT----AFTRDQLGRLEKEFYKEN 93

  Fly   319 YITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTR 354
            |:::|.|.:|||:|||.::.:||||||||||.:..|
  Fly    94 YVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQR 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/52 (46%)
eveNP_523670.2 Homeobox 74..126 CDD:278475 25/55 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.