DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and prd

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster


Alignment Length:140 Identity:48/140 - (34%)
Similarity:63/140 - (45%) Gaps:35/140 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 APTSPAA-AAAATSQNGAHGHGGGNGQGNAS----------AGSNGKRKRSWSRAVFSNLQRKGL 310
            |..|||. ...|:|..|:...||.:..|..|          .|...|||:...|..||..|...|
  Fly   164 ASGSPAGDGTKASSSCGSDVSGGHHNNGKPSDEDISDCESEPGIALKRKQRRCRTTFSASQLDEL 228

  Fly   311 EIQFQQQKYITKPD---RRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESG 372
            |..|::.:|   ||   |.:||.|.|||:|:::|||.|||.:.|           ||.::|  ||
  Fly   229 ERAFERTQY---PDIYTREELAQRTNLTEARIQVWFSNRRARLR-----------KQHTSV--SG 277

  Fly   373 GVFKTSTPSG 382
            |     .|.|
  Fly   278 G-----APGG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/55 (44%)
prdNP_723721.1 PAX 27..154 CDD:238076
Homeobox 217..269 CDD:278475 24/54 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.