DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and BARHL2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_064447.1 Gene:BARHL2 / 343472 HGNCID:954 Length:387 Species:Homo sapiens


Alignment Length:348 Identity:90/348 - (25%)
Similarity:112/348 - (32%) Gaps:138/348 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SFSVDRLLGSEPEESHRQSSSSPSTKSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPT 137
            ||.:|.:|.|       .||.||                    ...|.:.|..|.|..       
Human    10 SFGIDTILSS-------ASSGSP--------------------GMMNGDFRPLGEART------- 40

  Fly   138 SSHTYPFVGLDKLFPGPYMDYKSVLRPTPIRAAE--HAAPTYPTLATNALLRFHQHQKQQHQQHH 200
                              .|::|...|:|....:  ..||:.|...|  :.....|......|||
Human    41 ------------------ADFRSQATPSPCSEIDTVGTAPSSPISVT--MEPPEPHLVADATQHH 85

  Fly   201 HHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGK-----TPQQLLDIA--- 257
            ||.|     |.|..|||        ..||..||.  .|.||||....:     .||||...|   
Human    86 HHLH-----HSQQPPPP--------AAAPTQSLQ--PLPQQQQPLPPQQPPPPPPQQLGSAASAP 135

  Fly   258 --------------PTSPAAAAAATSQNGAHGHGGGNGQGNA-------------SAGSNGKRKR 295
                          .:.|.||.|..|.:.:..|.....:.||             |.....||:.
Human   136 RTSTSSFLIKDILGDSKPLAACAPYSTSVSSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKRED 200

  Fly   296 SWS--------------------------------RAVFSNLQRKGLEIQFQQQKYITKPDRRKL 328
            |.|                                |..||:.|...||..|::|||::..||..|
Human   201 SQSDIKCHGTKEEGDREITSSRESPPVRAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDL 265

  Fly   329 AARLNLTDAQVKVWFQNRRMKWR 351
            ||.|||||.|||.|:||||.||:
Human   266 AAALNLTDTQVKTWYQNRRTKWK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 30/84 (36%)
BARHL2NP_064447.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..145 47/203 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..240 11/82 (13%)
Homeobox 236..288 CDD:278475 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..387
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.