DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and scro

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster


Alignment Length:285 Identity:69/285 - (24%)
Similarity:113/285 - (39%) Gaps:89/285 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 HHHHQ----HHPKHLHQQHK----------------------------------PPPHNSTTAS- 224
            ||||.    ||.::||.||:                                  |.|..|.::| 
  Fly    85 HHHHNLSSIHHLQNLHSQHQSTLFNSNHSTPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSS 149

  Fly   225 ----------ALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIA-------------------PTS 260
                      :.:|..:::.:|..:...|.:.|  |...|.:|                   |..
  Fly   150 SINSPGTLTTSTMANPYAMGTLYHSPGVQTYCG--PTDNLSLAGHYTDMRNSASWYGSTANDPRF 212

  Fly   261 PAAAAAATSQNGAHGHGGGNGQGNASAGSNGK---------RKRSWSRAVFSNLQRKGLEIQFQQ 316
            ..:...::|.:|...|.|......|.:.|:.|         |||   |.:|:..|...||.:|:|
  Fly   213 AISRLMSSSASGTMSHMGNMSGLAACSVSDSKPLQFPLAQRRKR---RVLFTQAQVYELERRFKQ 274

  Fly   317 QKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKW-RHTREN--LKSGQEKQPSAVPESGGV---F 375
            |:|::.|:|..||:.::||..|||:||||.|.|. |..:|.  .:..|..||::.|....|   .
  Fly   275 QRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLV 339

  Fly   376 KTSTP-SGDGTPQEALDYSSDSCSS 399
            |...| ||:.:..::..:.::|.|:
  Fly   340 KDGKPCSGNNSSSQSQQHGTNSTSA 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/53 (45%)
scroNP_001015473.1 Homeobox 256..309 CDD:278475 25/55 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.