DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AgaP_AGAP003670

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_562540.3 Gene:AgaP_AGAP003670 / 3290880 VectorBaseID:AGAP003670 Length:458 Species:Anopheles gambiae


Alignment Length:372 Identity:82/372 - (22%)
Similarity:113/372 - (30%) Gaps:153/372 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 TPTSSHTYP-FVGLDKLF--PGPYMDYKSVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQH 196
            :|::..:|| :.|.|..:  |.||.                             :..|.:..|.|
Mosquito    52 SPSNHFSYPAYSGYDTSYHPPDPYG-----------------------------MISHGYLSQTH 87

  Fly   197 QQHHHHQHH-------------PKHLHQQHKPPPH---------------------NSTTASALL 227
              ||||..:             |..:...|.||||                     |:|::.||.
Mosquito    88 --HHHHDLNYGSASYDFGSSSMPSSIIPSHLPPPHYSHGQSYGSYGTHSTPVIGATNATSSPALS 150

  Fly   228 APLHSLTS-LQL---------------TQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGH 276
            :...|:.| |:|               ......||      |.|:.||....:....|.:|....
Mosquito   151 SVASSIGSELELGGYGSLDKSSLMNGHEHPCSNFL------LQDVRPTLLDTSTPLDSASGTQSP 209

  Fly   277 GGG-----------------------------NGQGNASAG-------------------SNGK- 292
            ..|                             |....|...                   .||| 
Mosquito   210 ADGIKIKDESFSSVSTCVTSEHVQELDSLCQLNNNNTAEEDMLQKECSTQLVTSSRSELRKNGKL 274

  Fly   293 RKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENL 357
            |.:...|.:||..|...||.:|:||:|::.|:|..||:.|.||..|||:||||||.|.:..:   
Mosquito   275 RAKRKPRILFSQGQVLELERRFRQQRYLSAPERETLASILKLTPTQVKIWFQNRRYKSKRVQ--- 336

  Fly   358 KSGQEKQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSE 404
                       .||..|.|....|..|.........|...||.|..|
Mosquito   337 -----------IESASVAKCDATSSTGVAGPRCPSDSSGSSSKDYDE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/52 (52%)
AgaP_AGAP003670XP_562540.3 HOX 277..333 CDD:197696 27/55 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.