DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AgaP_AGAP005346

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_555988.2 Gene:AgaP_AGAP005346 / 3289950 VectorBaseID:AGAP005346 Length:461 Species:Anopheles gambiae


Alignment Length:363 Identity:81/363 - (22%)
Similarity:130/363 - (35%) Gaps:134/363 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SCASTTIVSTSPTSATSTTKVKLSFSVDRLLGSEPEESHRQSSSSPSTKSCCDGSILACCSFPHC 114
            |..::|..|..|....:..:||.|||::.|| ::|:.|...|:||            |.|     
Mosquito     4 SVVNSTPSSMHPVDPVANNRVKNSFSIEHLL-AKPDRSGTASTSS------------AGC----- 50

  Fly   115 FSQANAESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPGPYMDYKSVLRPTPIRAAEHAAPTYPT 179
                                         :.|:|                      :..|.:||.
Mosquito    51 -----------------------------YRGMD----------------------DRLASSYPI 64

  Fly   180 LATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQR 244
            .                        ||..|        |||.....|:.  .|.::::...    
Mosquito    65 A------------------------HPAQL--------HNSMVYQTLMT--RSASAVEFLD---- 91

  Fly   245 FLGKTPQQLLDIAPTSPAAAAAATS--QNGAHGHGGGN-----GQGNASAG---SNGKRKRSWSR 299
             :.|.....:..|...|.:..|.:|  ::..:.....|     .:|:||.|   .:.::||  .|
Mosquito    92 -VNKNETSAVPFAADRPPSERAESSSPESSCNEDTMDNCSEIASEGSASGGLAAHDDRKKR--PR 153

  Fly   300 AVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWR------------H 352
            ..||..|.|.||.:|::.||::...|..||.:|:||:.|:|:||||||.||:            |
Mosquito   154 TAFSAAQIKALETEFERGKYLSVAKRTALAKQLHLTETQIKIWFQNRRTKWKRKYTADVESLASH 218

  Fly   353 TRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEAL 390
            ....|..|...:|..|.:...:| :.||:|. ||.::|
Mosquito   219 YYSQLGIGSFARPMVVGDRLWLF-SQTPNGP-TPVQSL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/52 (48%)
AgaP_AGAP005346XP_555988.2 Homeobox 152..205 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.