DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and B-H1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster


Alignment Length:277 Identity:69/277 - (24%)
Similarity:102/277 - (36%) Gaps:109/277 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 LATNALLRFHQHQKQQHQQHHHHQHH----------PKHL------------------------- 209
            ||.:|...|:: |:|.|||.|||.::          |.|.                         
  Fly    83 LAGSAAAAFYK-QQQHHQQLHHHNNNNNSGSSGGSSPAHSNNNNNINGDNCEASNVAGVGVLPSA 146

  Fly   210 --HQQHKPPPHNSTTASALLAPLHSL---------TSLQLTQ----QQQRFLGKTPQQLLDIAPT 259
              |.|..||.|..|...||:.|...|         ..|.:.|    .||.:.......   .|..
  Fly   147 LHHPQPHPPTHPHTHPHALMHPHGKLGHFPPTAGGNGLNVAQYAAAMQQHYAAAAAAA---AARN 208

  Fly   260 SPAAAAAATSQNGAHG------------------------------------------------- 275
            :.||||||.:...|.|                                                 
  Fly   209 NAAAAAAAAAAAAAAGVAAPPVDGGVDGGVGLAPPAGGDLDDSSDYHEENEDCDSGNMDDHSVCS 273

  Fly   276 HGGGNGQGNA-SAGSNG-----KRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNL 334
            :||.:..||: .:||..     .:|:..:|..|::.|.:.||..|::|||::..:|::||.:|:|
  Fly   274 NGGKDDDGNSVKSGSTSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDL 338

  Fly   335 TDAQVKVWFQNRRMKWR 351
            :|.|||.|:||||.||:
  Fly   339 SDCQVKTWYQNRRTKWK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/52 (46%)
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.