DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and exd

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster


Alignment Length:261 Identity:52/261 - (19%)
Similarity:89/261 - (34%) Gaps:84/261 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 IRAAEHAAPTYPTLATNALLR--FHQHQKQQHQQHHHHQHHPKH-LHQQHKPPPHNSTTASALLA 228
            |..|::|.......|..|.:|  :||..::..|..:....|..: |.:|.:..|........::.
  Fly   143 IDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQ 207

  Fly   229 PLH---SLTSLQLTQQ--------QQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQ 282
            .:|   |...:||.|.        :.|||                                    
  Fly   208 IIHKKFSSIQMQLKQSTCEAVMILRSRFL------------------------------------ 236

  Fly   283 GNASAGSNGKRKRSWSRAVFSNLQRKGLEI------QFQQQKYITKPDRRKLAARLNLTDAQVKV 341
                   :.:|||       .|..::..||      ......|.::..:.:||.:..:|.:||..
  Fly   237 -------DARRKR-------RNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSN 287

  Fly   342 WFQNRRMKWRHTRENLKSGQE--------KQPSAVPES--GGVFKTSTP-SGDGTPQEALDYSSD 395
            ||.|:|:::   ::|:...||        |...|.|.|  |....|:|| .....||:::.|...
  Fly   288 WFGNKRIRY---KKNIGKAQEEANLYAAKKAAGASPYSMAGPPSGTTTPMMSPAPPQDSMGYPMG 349

  Fly   396 S 396
            |
  Fly   350 S 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 13/58 (22%)
exdNP_001259592.1 PBC 41..237 CDD:397732 21/136 (15%)
homeodomain 239..299 CDD:238039 16/69 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.