DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and HOXC9

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_008828.1 Gene:HOXC9 / 3225 HGNCID:5130 Length:260 Species:Homo sapiens


Alignment Length:336 Identity:72/336 - (21%)
Similarity:123/336 - (36%) Gaps:114/336 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 STSPTSATSTTKVKLSFSVDRLLGSEPEE----------SHRQSSSSPSTKSCCDGSILACCSFP 112
            :|.|.|         ::.||.|:..:.|:          :| .:::.||      |.:..|..||
Human     3 ATGPIS---------NYYVDSLISHDNEDLLASRFPATGAH-PAAARPS------GLVPDCSDFP 51

  Fly   113 HCFSQANAESRRFGHATLPPTFT------PTSS----HTY---PFVGLDKLFPGPYMDYKSVLRP 164
            .|           ..|..|..|:      |:.|    |.|   |.:|.|..:...:::       
Human    52 SC-----------SFAPKPAVFSTSWAPVPSQSSVVYHPYGPQPHLGADTRYMRTWLE------- 98

  Fly   165 TPIRAAEHAAPTYPTLATNALLRFHQHQ-KQQHQQHHHHQHHPKHLH------QQHKPPPHNSTT 222
             |:..|. :.|::|....:..|:...:. ::........:.:|.:::      :...|....|..
Human    99 -PLSGAV-SFPSFPAGGRHYALKPDAYPGRRADCGPGEGRSYPDYMYGSPGELRDRAPQTLPSPE 161

  Fly   223 ASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASA 287
            |.||....|.                  ::..|:.|::|.|       |..|             
Human   162 ADALAGSKHK------------------EEKADLDPSNPVA-------NWIH------------- 188

  Fly   288 GSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRH 352
             :...||:   |..::..|...||.:|....|:|:..|.::|..||||:.|||:||||||||.: 
Human   189 -ARSTRKK---RCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMK- 248

  Fly   353 TRENLKSGQEK 363
                 |..:||
Human   249 -----KMNKEK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/52 (46%)
HOXC9NP_008828.1 Hox9_act 1..179 CDD:368024 38/229 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..181 9/78 (12%)
HOX 192..241 CDD:197696 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.