DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and HOXC8

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_073149.1 Gene:HOXC8 / 3224 HGNCID:5129 Length:242 Species:Homo sapiens


Alignment Length:232 Identity:60/232 - (25%)
Similarity:89/232 - (38%) Gaps:46/232 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 RAAEHAAPTYPTLATNALLRFHQHQKQQH----------QQHHHHQHHPKHLHQQHKPPPHNSTT 222
            :|.|...|.|..      .||.|...:.|          ....|..||.:...       |:.|:
Human    14 KAGESLEPAYYD------CRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFF-------HHGTS 65

  Fly   223 ASALLAPLHSLTSLQLTQQQQRFLG--KTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNA 285
            ..:......:..||.......:|.|  ..|:|.|..|....:.......::.|:.: ...|||:.
Human    66 GISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTN-SSEGQGHL 129

  Fly   286 SAGSNGKRKRSW----------SRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVK 340
            :..|:......|          .|..:|..|...||.:|....|:|:..|.:::..|.||:.|||
Human   130 NQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVK 194

  Fly   341 VWFQNRRMKWRHTRENLKSGQEKQPSA-----VPESG 372
            :|||||||||:  :||.|   :|.|.|     |.|.|
Human   195 IWFQNRRMKWK--KENNK---DKLPGARDEEKVEEEG 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 23/52 (44%)
HOXC8NP_073149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..154 6/40 (15%)
Antp-type hexapeptide 138..143 1/4 (25%)
Homeobox 153..205 CDD:306543 23/51 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..242 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.