DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and CG11085

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster


Alignment Length:125 Identity:44/125 - (35%)
Similarity:61/125 - (48%) Gaps:15/125 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 AAAATSQNGAHGHGGGNGQGNASAGSNG-----------KRKRSWSRAVFSNLQRKGLEIQFQQQ 317
            ||||:..||.....||:|.|:....|.|           .||....|..|::.|...||.:|:.|
  Fly   118 AAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQ 182

  Fly   318 KYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTR----ENLKSGQEKQPSAVPESGG 373
            ||::..||..:|..|||::.|||.|:||||.||:...    |.|:.....:...|.:.||
  Fly   183 KYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/52 (46%)
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.