DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and HOXB5

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_002138.1 Gene:HOXB5 / 3215 HGNCID:5116 Length:269 Species:Homo sapiens


Alignment Length:282 Identity:63/282 - (22%)
Similarity:99/282 - (35%) Gaps:97/282 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PTFTPTSSHTYPFVGLD--------------------KLFPGPYMDYKSVLRPTPIRAAEHAAPT 176
            |....|.|:.|.:.|:|                    :.||.|..:      |...:||...:.:
Human    37 PAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVGESSRAFPAPAQE------PRFRQAASSCSLS 95

  Fly   177 YPTL--ATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLT 239
            .|..  .||.                 ..|..|   .....|...:|:||         :|...|
Human    96 SPESLPCTNG-----------------DSHGAK---PSASSPSDQATSAS---------SSANFT 131

  Fly   240 QQQQRFLGKTPQQLL------DIAPTSPAAAAAATSQNGAHGHGGGNGQ-------------GNA 285
            :..:......|::..      .:|...|...|.:|:        ...||             .:.
Human   132 EIDEASASSEPEEAASQLSSPSLARAQPEPMATSTA--------APEGQTPQIFPWMRKLHISHD 188

  Fly   286 SAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKW 350
            ..|.:|||    :|..::..|...||.:|...:|:|:..|.::|..|.|::.|:|:|||||||||
Human   189 MTGPDGKR----ARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKW 249

  Fly   351 RHTREN-LKS------GQEKQP 365
            :  ::| |||      |...||
Human   250 K--KDNKLKSMSLATAGSAFQP 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 21/52 (40%)
HOXB5NP_002138.1 PRK07003 <67..>171 CDD:235906 22/146 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..173 22/138 (16%)
Antp-type hexapeptide 176..181 0/4 (0%)
Homeobox 198..251 CDD:395001 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.