DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and HOXA10

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens


Alignment Length:159 Identity:40/159 - (25%)
Similarity:67/159 - (42%) Gaps:51/159 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PPP----------------HNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAA 263
            |||                |.|::|:..|:|                              :|:.
Human   274 PPPTLACGSGGGSQGDEEAHASSSAAEELSP------------------------------APSE 308

  Fly   264 AAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKL 328
            ::.|:.:..:.|:..|....|.....:|::|    |..::..|...||.:|....|:|:..|.::
Human   309 SSKASPEKDSLGNSKGENAANWLTAKSGRKK----RCPYTKHQTLELEKEFLFNMYLTRERRLEI 369

  Fly   329 AARLNLTDAQVKVWFQNRRMKWRH-TREN 356
            :..::|||.|||:||||||||.:. .|||
Human   370 SRSVHLTDRQVKIWFQNRRMKLKKMNREN 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 14/94 (15%)
Homeobox 339..392 CDD:278475 23/56 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.