DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Gsc

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001178802.1 Gene:Gsc / 317715 RGDID:631425 Length:256 Species:Rattus norvegicus


Alignment Length:357 Identity:77/357 - (21%)
Similarity:115/357 - (32%) Gaps:140/357 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 FSVDRLLGSEPEESHRQSSSSPSTKSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTS 138
            ||:|.:|.:.|.              |.|                         |.||...:..:
  Rat     6 FSIDNILAARPR--------------CKD-------------------------AVLPVAPSAAA 31

  Fly   139 SHTYPFVGLDKLF---PGPYMDYKSVLRPTPIRAAEHAAP---TYPTLATNALLRFHQHQKQQHQ 197
            ...:|.:..|.|:   .|...|| ....|.|:      ||   ..|.....:.|.::.:...|  
  Rat    32 PVVFPALHGDSLYGAGGGTSSDY-GAFYPRPV------APGGAGLPAAVGGSRLGYNSYFYGQ-- 87

  Fly   198 QHHHHQHHPKHLHQQHKP----------------------PPHNSTTASALLAPL-HSLTSLQLT 239
                       ||.|..|                      ||......|.|::|: |.:    |.
  Rat    88 -----------LHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQM----LP 137

  Fly   240 QQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSN 304
            ......|.:|..|||                |..|                .:|||. .|.:|::
  Rat   138 YMNVGTLSRTELQLL----------------NQLH----------------CRRKRR-HRTIFTD 169

  Fly   305 LQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVP 369
            .|.:.||..||:.||.....|.:||.:::|.:.:|:|||:|||.|||..:.          |:..
  Rat   170 EQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKR----------SSSE 224

  Fly   370 ESGGVFKTSTPSGDGTPQE-----ALDYSSDS 396
            ||....|.:..|...:|::     ..|..|||
  Rat   225 ESENAEKWNKTSSKASPEKREEEGKSDLDSDS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 21/52 (40%)
GscNP_001178802.1 Homeobox 163..217 CDD:395001 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.