DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Arx

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001093644.1 Gene:Arx / 317268 RGDID:1562672 Length:566 Species:Rattus norvegicus


Alignment Length:190 Identity:66/190 - (34%)
Similarity:92/190 - (48%) Gaps:42/190 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 QLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGA-----------------HGHG--GGNGQ 282
            :|.:...|.|.|.|:: ..:|.|...|||||.:...|                 |...  |.:|:
  Rat   249 ELLEDDARALLKEPRR-CSVATTGTVAAAAAAAAAAAAVATEGGELSPKEELLLHPEDAEGKDGE 312

  Fly   283 GNA--SAGSNG-----KRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD---RRKLAARLNLTDA 337
            .:.  ||||:.     |||:...|..|::.|.:.||..||:..|   ||   |.:||.||:||:|
  Rat   313 DSVCLSAGSDSEEGLLKRKQRRYRTTFTSYQLEELERAFQKTHY---PDVFTREELAMRLDLTEA 374

  Fly   338 QVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTS--TPSGDGTP----QEALD 391
            :|:|||||||.||| .||  |:|.:..|..:|..|.:..|.  :|..|.:|    ..|||
  Rat   375 RVQVWFQNRRAKWR-KRE--KAGAQTHPPGLPFPGPLSATHPLSPYLDASPFPPHHPALD 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/55 (49%)
ArxNP_001093644.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..79
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..264 5/14 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..319 3/32 (9%)
Homeobox 336..388 CDD:278475 27/54 (50%)
OAR 530..547 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 534..547
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.