DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and HLX

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_068777.1 Gene:HLX / 3142 HGNCID:4978 Length:488 Species:Homo sapiens


Alignment Length:318 Identity:113/318 - (35%)
Similarity:144/318 - (45%) Gaps:83/318 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 KSVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPP------- 216
            :|.|||||:.|.......:|...:.....:|.|..||.||    |..|:   ||..||       
Human    90 RSPLRPTPVVAPSEVPAGFPQRLSPLSAAYHHHHPQQQQQ----QQQPQ---QQQPPPPPRAGAL 147

  Fly   217 ------------PHNSTTA----------------SALLAP-------LHSLTSLQLTQQQQ--- 243
                        ||:|.:|                ||...|       |..|||| ||..:.   
Human   148 QPPASGTRVVPNPHHSGSAPAPSSKDLKFGIDRILSAEFDPKVKEGNTLRDLTSL-LTGGRPAGV 211

  Fly   244 RFLGKTP---QQLLDIAPTSPAAAAA----ATSQNGAHGHGGGNGQG------NASAGSNGKRKR 295
            ...|..|   |....:.|.:.|:|..    :..:|...........|      ..:.....||||
Human   212 HLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKR 276

  Fly   296 SWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRE-NLKS 359
            ||||||||||||||||.:|:.|||:|||||::|||.|.|||||||||||||||||||::| ..:.
Human   277 SWSRAVFSNLQRKGLEKRFEIQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQAQK 341

  Fly   360 GQEKQPSAVPESGGVFKTSTPSGDG-----TPQ----EALDYSSDSCSSVDLSEQADE 408
            .::|:....| |||     .|:.||     :|.    ||...|||| .|:|::....|
Human   342 DKDKEAGEKP-SGG-----APAADGEQDERSPSRSEGEAESESSDS-ESLDMAPSDTE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 43/52 (83%)
HLXNP_068777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..173 16/61 (26%)
Abdominal-A 227..>344 CDD:332641 58/116 (50%)
Homeobox 279..332 CDD:306543 43/52 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 331..488 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159260
Domainoid 1 1.000 99 1.000 Domainoid score I7116
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4719
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009017
OrthoInspector 1 1.000 - - oto89889
orthoMCL 1 0.900 - - OOG6_110467
Panther 1 1.100 - - LDO PTHR46808
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.