DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Dmbx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001101431.1 Gene:Dmbx1 / 313512 RGDID:1308265 Length:376 Species:Rattus norvegicus


Alignment Length:247 Identity:64/247 - (25%)
Similarity:92/247 - (37%) Gaps:85/247 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 NALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLG 247
            :|:...||...||      .||.|     .::|..|..|.|                        
  Rat    18 SAMYNLHQQAAQQ------AQHAP-----DYRPSVHALTLA------------------------ 47

  Fly   248 KTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEI 312
               ::|.||..                         .|..||..:::|. ||..|:..|.:.||.
  Rat    48 ---ERLADIIL-------------------------EARYGSQHRKQRR-SRTAFTAQQLEALEK 83

  Fly   313 QFQQQKYITKPD---RRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQ-EKQPSAVPESG- 372
            .||:..|   ||   |.:||...||.:|:|:|||:|||.|:|..:.:|:..| :||..|....| 
  Rat    84 TFQKTHY---PDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQKEQLQKQKEAEGSHGE 145

  Fly   373 GVFKT-------------STPSGDGTPQEALDYSSDSCSSVDLSEQADEDDN 411
            |..:|             |.||||...:..|..|..|.|.....:|.|.:::
  Rat   146 GKMETPASNTQLEAEQPPSLPSGDPPAELQLSLSEQSASESAPEDQLDREED 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/55 (45%)
Dmbx1NP_001101431.1 Homeobox 69..122 CDD:278475 25/55 (45%)
BASP1 <123..239 CDD:283191 19/75 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.