DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Nkx2-3

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001101064.1 Gene:Nkx2-3 / 309389 RGDID:1308521 Length:362 Species:Rattus norvegicus


Alignment Length:248 Identity:64/248 - (25%)
Similarity:94/248 - (37%) Gaps:61/248 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 QQHHHHQHH-----PKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDI 256
            ||.|.|..|     .:|||           :|..:||...........::.:...|:....|..:
  Rat    22 QQRHFHGAHLQAELEQHLH-----------SAPCMLAAAEGTQFSDAGEEDEEEEGEKLSYLNSL 75

  Fly   257 APTSPAAAAAATSQNGAH-----GHGGGNGQ----------------------GNASAGSNGKRK 294
            |.......:....|:..|     ...|...|                      |:..|..:|:|.
  Rat    76 AAAEGHGVSGLCPQSYVHTVLRDSCSGPKEQEEEVVSERSQKSCQLKKSLEAAGDCKASEDGERP 140

  Fly   295 RSWS----RAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRE 355
            :..|    |.:||..|...||.:|:||:|::.|:|..||:.|.||..|||:||||||.|.:..|:
  Rat   141 KPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTSTQVKIWFQNRRYKCKRQRQ 205

  Fly   356 --NLKSGQEKQPS-----AVP---ESGGVFKTSTPSGDGTP----QEALDYSS 394
              :|:.|....|.     |||   ..|....|.:....|:|    ..|..|:|
  Rat   206 DKSLELGTHAPPPPPRRVAVPVLVRDGKPCVTPSAQAYGSPYGVGAGAYSYNS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 28/56 (50%)
Nkx2-3NP_001101064.1 Homeobox 148..202 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.