DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and nkx2.2a

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001295569.1 Gene:nkx2.2a / 30697 ZFINID:ZDB-GENE-980526-403 Length:273 Species:Danio rerio


Alignment Length:202 Identity:57/202 - (28%)
Similarity:82/202 - (40%) Gaps:64/202 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 TASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNAS 286
            |..::...||.|::     ..|....|:|:...|.:|.:.    ..||.||              
Zfish    82 TTDSIQYSLHGLSA-----NSQDTSAKSPEPSADESPDND----KETSSNG-------------- 123

  Fly   287 AGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWR 351
            :.|..||||   |.:||..|...||.:|:||:|::.|:|..||:.:.||..|||:||||.|.|.:
Zfish   124 SDSGKKRKR---RVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMK 185

  Fly   352 HTRENLKSGQEKQPSAVPESGGVFKTSTPS----------GDGTP-------------QEALDYS 393
            ..|      .||         |:..|..||          .||.|             |..:.:|
Zfish   186 RAR------AEK---------GMEVTHLPSPRRVAVPVLVRDGKPCHTLKAQDLAATFQAGIPFS 235

  Fly   394 SDSCSSV 400
            :.|..|:
Zfish   236 AYSAQSL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/52 (48%)
nkx2.2aNP_001295569.1 COG5576 93..218 CDD:227863 50/165 (30%)
Homeobox 132..185 CDD:278475 26/55 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.