DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and dlx3b

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_571397.2 Gene:dlx3b / 30585 ZFINID:ZDB-GENE-980526-280 Length:269 Species:Danio rerio


Alignment Length:282 Identity:66/282 - (23%)
Similarity:101/282 - (35%) Gaps:65/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 SSHTYPFVGLDKLFPGPYMDYKSVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHH 202
            |..||     |:..||...|....:...|   ....:||.|..:...:        ..:..||.:
Zfish     2 SGPTY-----DRKIPGISTDLSGSMSCHP---TSKDSPTLPESSATDM--------GYYSSHHEY 50

  Fly   203 QHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQ-----RFLGKTPQQLLDIAPTSPA 262
            ...|.:..|.:.....|.:...|......:.|.......:|     |.|...||..:...|.:..
Zfish    51 YQSPPYPQQMNSYHQFNLSGMGATPGAYPTKTEYPYNTYRQYGHYNRDLQTPPQSAVKEEPETEV 115

  Fly   263 AAAAATSQNGAHGHGGGNGQGNASAGSNGKRKR-SWSRAVFSNLQRKGLEIQFQQQKYITKPDRR 326
            ...                        |||.|: ...|.::|:.|...|:.:||:.:|:..|:|.
Zfish   116 RMV------------------------NGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERA 156

  Fly   327 KLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSA-------VPESGGVFKTST----- 379
            :|||:|.||..|||:||||||.|::...:|.:...|..|:|       .|.|..|:..:.     
Zfish   157 ELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNASDSMACNSPPSPAVWDNNAHSSQV 221

  Fly   380 -------PSGDGTPQEALDYSS 394
                   |....||....|||:
Zfish   222 NRGQIPQPPLSSTPPYMEDYSN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/52 (48%)
dlx3bNP_571397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 11/46 (24%)
DLL_N 28..104 CDD:289198 13/83 (16%)
Homeobox 128..181 CDD:278475 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..242 10/50 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.