DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and dlx2b

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_571372.1 Gene:dlx2b / 30557 ZFINID:ZDB-GENE-980526-18 Length:276 Species:Danio rerio


Alignment Length:212 Identity:58/212 - (27%)
Similarity:87/212 - (41%) Gaps:34/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 HPKHLHQQHKPPPHNSTTASALLAPLHSLT--SLQLTQQQQRFLGKTPQQLLDIA---------P 258
            |..|:........|.|..:..|  |:.::|  |...:.|.....|....||...:         .
Zfish    13 HTNHITSSSFSTVHKSQDSPTL--PVSTVTDSSFFSSSQTGHCAGTAYAQLASYSYHPGTVGNVH 75

  Fly   259 TSPAA-AAAATSQNGAHGHGGGNGQGNASAGS-----------NGKRKR-SWSRAVFSNLQRKGL 310
            .||.| .....|..||:|..|.:.....:...           |||.|: ...|.::|:.|...|
Zfish    76 YSPKAYDLGYASSYGAYGTYGASSSPTPTEPEKEESEPEVRMVNGKPKKVRKPRTIYSSFQLAAL 140

  Fly   311 EIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTREN--------LKSGQEKQPSA 367
            :.:||:.:|:..|:|.:|||.|.||..|||:||||||.|::...:|        :.||.....|.
Zfish   141 QRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKLWKNGEIPADQQVASGDSPSSSP 205

  Fly   368 VPESGGVFKTSTPSGDG 384
            .|::|..|..:....||
Zfish   206 PPQAGWDFPPNPTQNDG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/52 (48%)
dlx2bNP_571372.1 DLL_N 29..102 CDD:289198 16/74 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..123 3/25 (12%)
Homeobox 128..181 CDD:278475 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..238 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.