DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and emx2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_571355.2 Gene:emx2 / 30537 ZFINID:ZDB-GENE-990415-54 Length:247 Species:Danio rerio


Alignment Length:294 Identity:75/294 - (25%)
Similarity:111/294 - (37%) Gaps:81/294 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 FTPTSSHTYPFVGLDKLFPGPYMDYKSVLRPTPIRAAEHAAPTYPTLATNA--------LLRFHQ 190
            |.||....:....|             |.:..|:.::....|..|...:.|        |..||.
Zfish     2 FQPTPKRCFTIESL-------------VAKDNPLPSSRSEEPIRPAALSYANSSQMNPFLNGFHS 53

  Fly   191 HQKQQHQ----------QHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQ-- 243
            ..:..:.          .|..:...|.|    ..||||  ..|:..|:..||...|..:||:.  
Zfish    54 SGRGVYSNPGLVFAEAVSHPPNSAVPVH----SVPPPH--ALAAHPLSSSHSPHPLFASQQRDPS 112

  Fly   244 ----------RFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWS 298
                      |:||...|.    ..|||.:...         |       ||.|     ||....
Zfish   113 TFYPWLIHRYRYLGHRFQG----NETSPESFLL---------H-------NALA-----RKPKRI 152

  Fly   299 RAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEK 363
            |..||..|...||..|::..|:...:|::||..|:||:.||||||||||.|::  |:.|:  :|.
Zfish   153 RTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFK--RQKLE--EEG 213

  Fly   364 QPSAVPESG--GVFKTSTPSGDGTPQEALDYSSD 395
            ..|...:.|  .:.:....:..|:|:| :|.:||
Zfish   214 SDSQQKKKGTHHINRWRLATKQGSPEE-IDVTSD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/52 (48%)
emx2NP_571355.2 Homeobox 153..205 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.