DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and emx3

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_571354.1 Gene:emx3 / 30536 ZFINID:ZDB-GENE-990415-53 Length:233 Species:Danio rerio


Alignment Length:245 Identity:66/245 - (26%)
Similarity:98/245 - (40%) Gaps:53/245 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LRPTPIRAAE--HAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTAS 224
            :|||.:|..|  |.:|.....              |:.....:...|:.:...    |...:|.|
Zfish    30 IRPTALRFTESIHPSPFGSCF--------------QNSGRTLYSSSPEMMFTD----PSTHSTNS 76

  Fly   225 ALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGS 289
            .|     ||..||:..|.  |.....:..|:..|.        ..:|...||   ..||:.|:..
Zfish    77 GL-----SLRHLQIPTQP--FFSPHQRDTLNFYPW--------VLRNRYLGH---RFQGDDSSPE 123

  Fly   290 N------GKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRM 348
            |      ..||....|..||..|...||..|::..|:...:|::||..|.||:.||||||||||.
Zfish   124 NLLLHGPFSRKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLANGLCLTETQVKVWFQNRRT 188

  Fly   349 KWRHTRENLKSGQEKQPSAVPESGG---VFKTSTPSGDGTPQEALDYSSD 395
            |  |.|:.|   :|:.|....:..|   |.:....:..|:|:: :|..|:
Zfish   189 K--HKRQKL---EEESPDPQQKRKGSQHVSRWRVATQQGSPED-IDVISE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/52 (48%)
emx3NP_571354.1 Homeobox 139..191 CDD:278475 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.