DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and rx2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_571301.2 Gene:rx2 / 30473 ZFINID:ZDB-GENE-990415-237 Length:327 Species:Danio rerio


Alignment Length:203 Identity:51/203 - (25%)
Similarity:83/203 - (40%) Gaps:46/203 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 LLAPL--HSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHG----------G 278
            ||.|:  |.:...|| ::|::.:...|...|.|...:      ...|:..|..|          .
Zfish    52 LLEPIGTHKVDEDQL-EEQEKQVNSDPYSHLQIPDQT------QQQQSVYHDTGLFSTDKCDADL 109

  Fly   279 GNGQGNASAGSNG---------KRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNL 334
            |:.:.|..:.|..         |:|...:|..|:..|...||..|::..|.....|.:||.::||
Zfish   110 GDPRSNVESDSRSPDIPDEDQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNL 174

  Fly   335 TDAQVKVWFQNRRMKWRHTRENLKSGQEK----------QPSAVPESGGVFKT-------STPSG 382
            .:.:|:|||||||.|||. :|.:.:|..|          :|...|..|.:..:       |:|..
Zfish   175 PEVRVQVWFQNRRAKWRR-QEKMDTGTMKLHDSPIRSFNRPPMAPNVGPMSNSLPLDPWLSSPLS 238

  Fly   383 DGTPQEAL 390
            ..||..::
Zfish   239 SATPMHSI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 21/52 (40%)
rx2NP_571301.2 Octapeptide motif 37..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..73 7/21 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..139 5/38 (13%)
Homeobox 139..191 CDD:278475 21/51 (41%)
OAR 302..316 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 304..317
Nuclear localization signal. /evidence=ECO:0000255 310..314
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.