DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and rx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_571300.2 Gene:rx1 / 30472 ZFINID:ZDB-GENE-990415-236 Length:330 Species:Danio rerio


Alignment Length:202 Identity:48/202 - (23%)
Similarity:76/202 - (37%) Gaps:42/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 PKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQ 270
            |..|.|:.:|..|        |.||...:..........|..|....|.|:.....:.:.:..|.
Zfish    72 PGKLDQRVQPYGH--------LPPLRDGSEQPTFHDADMFSNKCDGDLGDLRKAIESDSKSPDSA 128

  Fly   271 NGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLT 335
            :                |...|:|...:|..|:..|...||..|::..|.....|.:||.::||.
Zfish   129 D----------------GEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLP 177

  Fly   336 DAQVKVWFQNRRMKWRHTRENLKSGQEK----------QPSAVPESGGVFKT-------STPSGD 383
            :.:|:|||||||.|||. :|.:.:...|          :||..|..|.:..:       .:|...
Zfish   178 EVRVQVWFQNRRAKWRR-QEKIDASTMKLHDSPMLSFNRPSMHPTVGPMNNSLPLDPWLPSPLSS 241

  Fly   384 GTPQEAL 390
            .||..::
Zfish   242 ATPVHSI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 21/52 (40%)
rx1NP_571300.2 Octapeptide motif 37..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..104 8/39 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..142 4/39 (10%)
Homeobox 141..193 CDD:278475 21/51 (41%)
OAR 302..318 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Nuclear localization signal. /evidence=ECO:0000255 312..316
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.