Sequence 1: | NP_523488.2 | Gene: | H2.0 / 33841 | FlyBaseID: | FBgn0001170 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571300.2 | Gene: | rx1 / 30472 | ZFINID: | ZDB-GENE-990415-236 | Length: | 330 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 48/202 - (23%) |
---|---|---|---|
Similarity: | 76/202 - (37%) | Gaps: | 42/202 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 206 PKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQ 270
Fly 271 NGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLT 335
Fly 336 DAQVKVWFQNRRMKWRHTRENLKSGQEK----------QPSAVPESGGVFKT-------STPSGD 383
Fly 384 GTPQEAL 390 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
H2.0 | NP_523488.2 | Homeobox | 298..351 | CDD:278475 | 21/52 (40%) |
rx1 | NP_571300.2 | Octapeptide motif | 37..44 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 66..104 | 8/39 (21%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 118..142 | 4/39 (10%) | |||
Homeobox | 141..193 | CDD:278475 | 21/51 (41%) | ||
OAR | 302..318 | CDD:281777 | |||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 306..319 | ||||
Nuclear localization signal. /evidence=ECO:0000255 | 312..316 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |